SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|32660|fgenesh1_pg.25_#_68 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|32660|fgenesh1_pg.25_#_68
Domain Number 1 Region: 154-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000635
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|32660|fgenesh1_pg.25_#_68
Domain Number - Region: 102-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0155
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|32660|fgenesh1_pg.25_#_68
Sequence length 442
Sequence
MSDMPDSPLSSISSSDEADDMISTPNRSARPSIDTDTTGPPSKKRRTGGGPAHISSSHGG
TIMVAGADTIEESEADISCDSEGSAPGSPSQDEFAMRADQVTTCAWEGCSVGDLANSDEL
IAHVQNDHIAPKRARYTCEWGDCARKGTNHPSGYALKAHMRSHTKEKPFFCHLPECDRSF
TRSDALAKHMRTVHEPEPPRAAATNANPIDPATGQPKKGPKLRLSMNGKTPIKPSVPDVP
VPAPTQAPDDPSPPMDNIQYIPARHPITGQAGFMITYPPDIHFSQFESEIPANQLMRLLR
RQLHWAQQESEGLKQEVEALEEHHRQEWAAKEALLEGVLQSELAATKQLDETTLHEMKEE
VWGPESKELEWTGTPPWQREGNHKIEEPESPRDVDVDVDVDVDDAVVVANRAANAQQESA
SQAERDEDMMAVGALMGLSGAA
Download sequence
Identical sequences A0A074Y2G9
jgi|Aurpu_var_sub1|32660|fgenesh1_pg.25_#_68 XP_013340371.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]