SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|33056|fgenesh1_pg.29_#_59 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|33056|fgenesh1_pg.29_#_59
Domain Number 1 Region: 121-486
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.65e-97
Family Glutamine synthetase catalytic domain 0.0000384
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|33056|fgenesh1_pg.29_#_59
Domain Number - Region: 23-119
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000405
Family Glutamine synthetase, N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|33056|fgenesh1_pg.29_#_59
Sequence length 488
Sequence
MAISDDPTALKLEDLAELLKNDTSVKLAGCDIDGILRGKLVSKKKFLSIAESGFGFCSVI
FGWDMHDQTYFKELKISNKENGYRDLTAQIDLGSFRRIPWENNVPFFLVSFYEPEGQSVS
ACPRSVLGRAVEKIQAKGMSAMAGAEYEFYQFRAPSDPTASERNSSSTAKFLKDHPPSAL
PSLTEGMFGYSVARPVHNQDYYYGVYDACEKFRCNIEGWHTESGPGVFEAALEFGEIRGM
ADRAALFKLTVKSIASKFGITPCFMAKPRENLPGNSGHMHVSLCDPETNQNLFARSEPDP
NAPYEDIKHLSDLGRHFLAGLIEGLPYVMPIFAPTINSYKRLVENFWAPVTVSWGLEHRA
ASIRLIAPPTASPKSTRFEVRVPGADTNPYLVLATILALGWRGVEKKLEIPIPPLGKGED
VGGASDSGVRLAKSLREATEKFKSKDSIAREVFGDDFVDHFAGTREHELRLWDEAVTDWE
FKRYIETV
Download sequence
Identical sequences A0A074Y157
jgi|Aurpu_var_sub1|33056|fgenesh1_pg.29_#_59 XP_013339924.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]