SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|33756|fgenesh1_pg.38_#_23 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|33756|fgenesh1_pg.38_#_23
Domain Number - Region: 251-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000643
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|33756|fgenesh1_pg.38_#_23
Sequence length 336
Sequence
MNNYVFQDDQPLYNQGRSFEYALPMDDHSWSAYQGLVDTMDLNQQRRPATALPSVDSSLL
FPYFTDSSKGLRSTSQLLQSEQQGNNVPCTGVQDFEQFSHDANSIWTTEFPKFQRQQLQA
GSGVSFPSDLETWLISQSVSLPNEPWDNDPSITMRLESVSSNPSLPMHSHELAQPLPQAY
AHGFPTCTTETLPIDQWNDSGSSPTDSWDSEAIGYTSLDFTKMLPHENPVYKSASINSRK
DLRCWDHGCQGRAFSSRSNLRRHQREQDARVKLLPCPFCGTNFYRKWTRDQHVARMSCKK
SDRYILALEAYLSRLTHDHGLMTSANFHNTAVASQE
Download sequence
Identical sequences A0A074XYR2
jgi|Aurpu_var_sub1|33756|fgenesh1_pg.38_#_23 XP_013339140.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]