SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|39843|fgenesh1_kg.10_#_93_#_Locus3935v1rpkm35.30 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|39843|fgenesh1_kg.10_#_93_#_Locus3935v1rpkm35.30
Domain Number - Region: 50-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000113
Family Classic zinc finger, C2H2 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|39843|fgenesh1_kg.10_#_93_#_Locus3935v1rpkm35.30
Sequence length 303
Sequence
MVVSSTSRSAAVPEQASHDSASEVRPAPVDNEKDQDFSSDSDDASNSSQALDFNATHCLF
CSNISDDIDTNLIHMSKSHGMTIPSPHQLSVDPTTLLNYLNLVISLDHECLTCGTQRRNT
QAIRQHMLGKGHCAFDISDVESEYREFWEFEVDDEKAEVDGDNITLPSGRVVTSRSSRAT
QQRRRLQASDMGASPDTLTSGEGTTEASSSSTIISQSSGKQTLTKQDLRALNHGKQLGAL
RASDRLALAHLPASEQRAILDSQHKQLQKARRQERDMQARLQRKNNQTLMKHFVPDVPGP
KLG
Download sequence
Identical sequences A0A074YC32
jgi|Aurpu_var_sub1|39843|fgenesh1_kg.10_#_93_#_Locus3935v1rpkm35.30 XP_013343843.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]