SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|44602|fgenesh1_kg.35_#_7_#_Locus3824v1rpkm37.01 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|44602|fgenesh1_kg.35_#_7_#_Locus3824v1rpkm37.01
Domain Number 1 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000225
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 225-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000534
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|44602|fgenesh1_kg.35_#_7_#_Locus3824v1rpkm37.01
Sequence length 614
Sequence
MATRVRSDSPQVEPFPPLEVPHTPTLASHSAFAKDNHHLFKPRAPDYTAVSPKSPARFSP
RPLTGAAAQADARRLQQQQQSHESSQTSANPAATALHALMSGPGMSKASDLASPNFSPSS
QMRKPSTHLTVPVTTTAEASQPSPVSLRSFGDSDAVSPNGAMTTTAHEHARDTQMVAEPA
EMTSMDYPEPTRGYNSASSAHPSHKSFTYPGPASVAAEAAAEGQSRASPSTKRHKCPYCA
TDFTRHHNLKSHLLTHSQEKPYVCQTCQSRFRRLHDLKRHTKLHTGERPHICDKCGRRFA
RGDALARHNKGPGGCAGRRSSFGGDDDSRMGDEGMDGMEYTDNGENGHDMDDEDDNPRRE
SEPSRKRAHIEDSHDPNRSIYRQHSSTYPPPLASRTHRGNMGPPNHHILPSSNAVTSPGE
ITNMNPTSNMALNPYGSTPTVVLGEGGISHSPKPLSPNQQDQHRLSIAEATSAMRNRSPS
LTQIQQAHNARNGQATPPAPHQMSQHTQLPSLAGLASGHSMRLPIQSAAHNSMHNNMQSG
PMHGSNPGSLSSHGHSSGGSMREIVGDGINDVWNYVRALEQRFSRMQDEYELRISRLQED
LIAIKGHLSFQQPR
Download sequence
Identical sequences A0A074Y4H8
XP_013339379.1.23603 jgi|Aurpu_var_sub1|44602|fgenesh1_kg.35_#_7_#_Locus3824v1rpkm37.01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]