SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|47444|fgenesh1_pm.15_#_20 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|47444|fgenesh1_pm.15_#_20
Domain Number 1 Region: 12-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000427
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|47444|fgenesh1_pm.15_#_20
Sequence length 726
Sequence
MASIESVANTGKKLECRFCQRIYSKAEHLTRHERSHTGVRPFTCKECNRAFSRQDSLARH
EKLHLRRESMKCASPPSSIYTPAKSNALQHLLAADEDIESHNYVPPTDHSTSQTWHEQSY
QVESDMMDMHCATDLDFQLIWPDSEELFQSIMSTDTTTHMPVGTLPFPQGLDQFTPTSLD
SPTSFDDRGTAIKSIPNGGGHQAVHGVSKMISNLSSSITAEAEATSITSVFLDECLHMFF
VRFIPTFPVLHRSTFVFKECTHPLLLNAIAIGSLYLGPKDAIAKGEALWRLSHTAVATSW
QSLITHRGPYDPCNGLQLVLAALLGQVYAALSKNRALRTTSQIFHALGFSWARHCGMYDN
DTFSLDGLPSLDASPAEKDRQWKTWAAHEIQRRALLAQYILDGLVSSASGNPTSTRHAAN
QLGLPCDESLFEASTADEWLIKMRSQPRQDVSFRNIFRSLFLPVDMGRLPEHTLTSFSLR
VILEGVQSLVSDSTDGPSIGVPTRSEIRRALAQVHESITKNTISTPETLEALLRWHSICL
DAATDSSMLCRHLCARYNIPQHVLGGNRGLKAGLDLVAWAKTEDARRALLHAVAIQDIVE
QLPRGRAHVLHMPSSLFAAATVYSVFSLAGHTTVNLPRVVDWKDALFTEVDPCVILGDLA
GTSAGSSPTRRFVRGEQLSSSGYESMTRNLLYELNSMQKLFRCLSSQWGLAYDMEVVLNS
WISLSH
Download sequence
Identical sequences A0A074Z447
XP_013342353.1.23603 jgi|Aurpu_var_sub1|47444|fgenesh1_pm.15_#_20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]