SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|47591|fgenesh1_pm.17_#_3 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|47591|fgenesh1_pm.17_#_3
Domain Number - Region: 48-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000194
Family HkH motif-containing C2H2 finger 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|47591|fgenesh1_pm.17_#_3
Sequence length 233
Sequence
MDYQNRAGSKFGGGGVASASATNADRRERLRKLALETIDLDKDPYIFKNHVGSFECRLCL
TVHQNDGSYLAHTQGRKHQTNLARRAAREAQLGKDRDQNLSGLSQVQIKKNVVKIGRPGY
KITKTRDPLTRQLGLLFQLQYPEISQDVEPKVRFMSAFEQKVEEPDKQFQYLLVAAEPYE
TCAFKLQAREIDRSEGKYWTWFDGDSKEFWVQVTFKTEREERYSGVPGLAPRR
Download sequence
Identical sequences A0A074Y695
XP_013341834.1.23603 jgi|Aurpu_var_sub1|47591|fgenesh1_pm.17_#_3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]