SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|535555|CE421441_3887 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|535555|CE421441_3887
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000319
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 61-107
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000144
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|535555|CE421441_3887
Domain Number - Region: 409-472
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0667
Family Outer membrane efflux proteins (OEP) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|535555|CE421441_3887
Sequence length 843
Sequence
MFECGTCHKSYATQSSLTRHAHNHESGRRHTCAVCDISFRRRDLLARHEKIHDTGHDDVE
GERRRCHTACEACRKNRVKCDGQQPCGSCSRTQSTCSFQRPARRISRKAHQELSSDDGDD
ESGGQRLTEHHGNAGYAHGQAGELQVSPMLLGTNTFAAEQSSMTQGSLEAGSLGQIQPSL
EDHEFANILASMHHATDAELESVPELWPPTINWPWAHEQLYLRDGPDYGPYGVADLDGLQ
LSVDSMASQHVDMIGAGNATEQGSGGNTIDESLLAISPISMTPTRVIDSIVREAVEVARD
NSRWAEFWNSASNQISVAFNISAAPEVPQGVNVLEHFSNIYLEQFQPLWPLLWQPGLELD
KLHPLLLLTITSIGALYSGVTSSRYGSLLHEKMREVLLVSPPRTDQTDQENLDLGRAMLL
TQVAAIYFEQQHAFSAAQRLGALLNAHAQKMRLFSYRSRRGMPTPLDLTQANNVSAIQWH
KQWVFAEGCKRLAYGVVRGEVFMSVLLDSKPLASYEEVDLELPYSDTLWTTKRQFAREYI
SAVGREHSLCRGMIFSDLVRVALDPNEVLPLLQPLEHELLLYGLQYSVWRFSHDPSMFKR
LTGHDATKESAPTTSDFESAGLDHDHLVDRDHLDYSTRKMRDLLRERQNVICALRKWKDM
VASSQMSNQYGHNRTTYLSGLMLFHLSFLRLHAPVGLIQEVVYHNGSPSEAVKVSIQTIA
DWSRTNEALVAIKHACSMWTLIEKETSRKALPQARYTILTVIAVYQAATVIWAMAGACDT
SRHSLNMMGSSKQIDKDKVELSKSNISNLMQSFAELFPDMTSTWGTQSSFSKMVLELATR
TLI
Download sequence
Identical sequences A0A074Y8P4
XP_013339118.1.23603 jgi|Aurpu_var_sub1|535555|CE421441_3887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]