SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|6643|gm1.6643_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|6643|gm1.6643_g
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000277
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 2 Region: 70-113
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000397
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|6643|gm1.6643_g
Sequence length 968
Sequence
MVFCTYCGHSFTRDEHLERHILTHTNVKPFKCFTCHMSFARRDLLQRHYTVHGRDQNQEI
IPAANGMMAKSAGRTPIACSNCAKTKTKCDKKFPCSRCAGRNLRCTLRPTRRSSKNANRM
GLITAETIASGVANGILPPDQTVAAEAAPMPIDSSKSAEKHQHQKPSSPGSGVPTTIPEE
KHMGDLHAQYFEQPMSNGHTSPSQQISPLTTPGSGFMQGSMPTYDDFMNGTKEDDANPRF
MLDWGQMPMPMGFEAMARADLMLDPSMGFDPNQLSLMPANETILTIMPDMANLGGPLISP
IETPKVERSFADMDLGHSNNMFYAHARHMSTASLSSNDGEDIRAVIAAQDGWNVFRCTPT
VPSSSCPTTAKMNLECLEQTLKNHEGWSTWAPTWDEADFAGAENLAVMQLHESTRDKLLA
ITQTFLHKALETHREGQQGGQSPLSNGGSNFVLLPPARVLEYFLRSYANSFERYYSLTSR
GILDANELMHCYNDKASCLLLLMMIAQGAMNISSVEARWLAGGLTEACRISLFDLIERNI
TMASDPITLHSALLFTSQAAWSGDKWQMDIAMGQRSMYFHMLRHSGLLEGRAFTAPQMMD
HQNSADSLWTEWIQRESRSRLVYSWVMVDQDLALFHDTAPLFSVTEFGAPMPDSDRLWQA
KSAPEWSQAFEQVHEFVGGYSSLGSGARPMSLHDLFRHFLDDEMASLGIGMTPLQMRLLL
HPLQSMVCHYGQLMSCFSDSLSSRNKTRAVTASSTRCRLEEVQSLLQRWYDMADRYLKVN
PSCAVMQANLVMFHLISLNAVTNFPEVERLARREGFDGTYQQLIWIHKRCIADVEEAVFH
CGQVLRIIRSMPRGVRPPWWAGAIYRAALILWTDSLINKESPAPTATGGFPSPGPTFAID
ALPADHPTIVRFLSKRVGQPFLSKRNGSHLPMDHGVTVLAHSIEIMDEGTSNRFVDGVRN
KLDRLMRS
Download sequence
Identical sequences A0A074Y788
XP_013341962.1.23603 jgi|Aurpu_var_sub1|6643|gm1.6643_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]