SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|6770|gm1.6770_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|6770|gm1.6770_g
Domain Number 1 Region: 41-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000258
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|6770|gm1.6770_g
Sequence length 1144
Sequence
MDHSPEGISPTSADPAIAANAPPSQPAKTQAKFPPPKTDKPRPHVCGTCGRSFARLEHLK
RHERSHTKEKPFECQECKRCFARRDLLLRHQQKLHFTNNPSSRPKNNRRESTSGPVNGGR
VRKGSIANAGTGAGNAGGRPRANTLGHLDLGSLGLMGVVAPAEAQRPSHASMAHHRMSMS
NAQQRPSNLDLHSINNMTHSGMGQQDGFDLSRVDTHTSHIDFGEPLTHIHTAPAYTGMQH
SDLEQIFTPGGNTINPAQLHFAASTAPQPVNLQSFHMNQFDLFGQGDDFAWMRDWDSQLQ
SHTNNEAIDQSSPSQFSTTSQSGYSETVTDGPFHINVSQAGWNPNDMQALMTPGALNLDI
LGTGLPSIDPPMNTISPHNLQDPSATADSKLGALMMHGVSDPLGGMHFNQFQQPSLSNFD
SDSPSISSSSVPDSARQSSVTSISTDSITDATRQALLLSLSQPSAFSHRKFSQPSISSPL
SPRPQGPSLPSTADLQRYINAYIQFFHPHLPFLHIPTLSFDSPEYMTNLRTAGAQASVNH
SGVIGGGGCLILAMAAIGALYEYDHQASKELFDSAKKMIQLYLEERRKADMSAAVNGGQY
FSSESSSTNTPLWLVQAMLLNVIYGHYCGDKTAADIASNHCAALVSLARAAELAQPTTDL
DNFVDVKDDKTDVHMDDGSSPFHGHTNVHLHWLKWKEAEERKRTLFAIFILSSLLVIAYN
QTPAITNSEILLALPCDEELWTADGAREWAARGGAQAAEASATPFAAALSNLLTANQRQQ
NMFAYNVYSPNGDSHAASGQLRPSTFGCLVLINALHNYIWETRSRHIGRQWTAQETESMV
AHIEPALNAWQAAWKANDRHKLQRPNPFGLGPLAADSIPLLDLAFVRLFVNLGRSKEAFW
QRDFEAMSEELASGIDIAQTGSPDHNSNSSSGGSPNFMQGNYSHGQSSISGHSTKRERHL
RKAAFYAADSLVISSKCNLTFADSSAHELPIQSAICFLDCAQVLAEWETTVQERIGRYVG
ILGQADVDYGQVPAVMLLDTEDVELLKKMESICASMEDKMALQAKMLAHEMDSLDPSGGM
GLASPLERLNGLSKYGLGSRILRMTAQMLEKAAVWPVTHVMASALETQASHADQRADSSI
NAVS
Download sequence
Identical sequences A0A074YB73
jgi|Aurpu_var_sub1|6770|gm1.6770_g XP_013341704.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]