SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|696471|MIX1275_7_43 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|696471|MIX1275_7_43
Domain Number - Region: 249-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0186
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|696471|MIX1275_7_43
Sequence length 364
Sequence
MPPIFKEPDLTAEDIARGDRHRTHGSPWVLFLRPRSDFDGSAWCTVHQNAWELVLKVLRF
ARTVDDAYYEAAMVAMRRWNADHAMSADPTHFLIYLEQQIQMEGGRLRENSYIWRAYSDC
NGPQTLTFSRFEDSSPTEPNLAVDETSAEFFLAETMLNYRLRSLAYISNEECKVELRLDR
RSLLGVPLTSPAMVMDATREAYTAVNKVIPNWLTLQLPAHLAPLSLSSPTPSHGRQTPSQ
GNPLGIIKRPHKCPFCRSCFSTEPRRDTHIQSVHGGQIALAAQQHATDQIPAAPTTSAPP
GCAPASDTPLGYAPASAIPWEYAPTSAIPLGPQSSATAEPEIGDEEETGPVEIVPHGSPD
SVQP
Download sequence
Identical sequences A0A074YU63
jgi|Aurpu_var_sub1|696471|MIX1275_7_43 XP_013348443.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]