SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|7495|gm1.7495_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|7495|gm1.7495_g
Domain Number 1 Region: 334-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000937
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|7495|gm1.7495_g
Domain Number - Region: 387-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00938
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|7495|gm1.7495_g
Sequence length 445
Sequence
MNVHEEDFAHSIPSKKVNSLAGFDHGFADRSVVPPDQRPPALGYMPLPEPRAELSHSASQ
DPYHFADRRSDRPMNGRNLNLRTMTNTASMPEYNTYLERDHTGSPLQRAHSVHSTGHLPP
GMYPPLRPEGPTEQTVSSPQTDRRLPSFHQLSKIADSGPETGDTRATGLPNLATYTGQII
PQTATASHHHFAPSQQSSPSTNLMMLGHPSPTNTRNDGHEAYAPSHSPASFSAPNNNFDH
RRKSAQHNRPPPFIPTMTSSSMGTGSSMETVPSLQSQHSSEGPGYSTNHTTPMGSANSSL
DGTTKSSGVPRLHNSTSAPSGFLCEYPGCSAPPFQTQYLLNSHANVHSSSRPHYCPVKGC
PRGEGGKGFKRKNEMIRHGLVHDSPGYVCPFCPLREHRYPRPDNLQRHVRVHHVDKDKDD
PLLREVLAQRPEGGGRGRRRRAGPT
Download sequence
Identical sequences A0A074Z0X6
XP_013341112.1.23603 jgi|Aurpu_var_sub1|7495|gm1.7495_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]