SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|75469|estExt_Genemark1.C_0_t10316 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|75469|estExt_Genemark1.C_0_t10316
Domain Number - Region: 64-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000202
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 121-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000438
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|75469|estExt_Genemark1.C_0_t10316
Sequence length 201
Sequence
MADDTVSHEQRHMLLSLIERYKEIDFDEVAAKTGIETAAQAEQALNHILQKIAGHESDED
TISDEHVEVCKWPGCQEIFSTSIELRDHLMTHTAGLRGAERIEQCRWPGCTYEKTLTTRW
SIHFINHVSDKGFHKCQRCSKSFSRASDFNKHNKEKHPSLAPAQETEAEADAEVGDEDGE
EVEVHTGDETKGAVEEKTKEE
Download sequence
Identical sequences A0A074YRI9
jgi|Aurpu_var_sub1|75469|estExt_Genemark1.C_0_t10316 XP_013348866.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]