SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|82977|estExt_Genemark1.C_270086 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|82977|estExt_Genemark1.C_270086
Domain Number 1 Region: 83-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000374
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 290-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000012
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 3 Region: 145-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000722
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|82977|estExt_Genemark1.C_270086
Domain Number - Region: 191-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00194
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 260-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0756
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|82977|estExt_Genemark1.C_270086
Sequence length 508
Sequence
MCATGEKRKAASDDVPDSVKRSRVGDTHDLSDEGSDKGDTFSVASPVSTPGTSTQPSSPK
SSKAPSKPRQNKYACDFEGCTKSYSRPVRLQEHKRSHTNERPFSCPQEGCDKTFLRESHL
KHHIKAKHDDVRDYVCDWPDCDKGFHTAQRLKQHKKTHETSKPDFLCTDFPPCNQNFRKQ
DTLDRHIQLVHLHEKPYLCDQTDRFTGLPCDARFKTSTHLIAHKDREHSGNRFWCKICSP
EMADLDPGLNQDAFAMAVGFPTYIEMQQHIKTVHPPTCLQCGHICASNRDLKAHMEIQHG
DIEDRRNYVCDYPDCGRGFTKKGNLVVHQKSVHGKQKQFICGETDITGSKRVPAWDGRGA
CGRAFSAKANLEEHVRTQHLHLPGYVRPAKRTKQEEDDSFTAFPPEDHNTVLARLTGVGY
EHGRDIACLDDTCQHRFIKPFDLEVHLEIVHGYTKTEAIEATVEREALSGGQFWLGGLSP
DFEEQRLAQQLDLALHPHDDMMDPYQDA
Download sequence
Identical sequences A0A074Y6Z0
XP_013340195.1.23603 jgi|Aurpu_var_sub1|82977|estExt_Genemark1.C_270086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]