SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|8308|gm1.8308_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|8308|gm1.8308_g
Domain Number 1 Region: 141-389
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.81e-68
Family Glutamine synthetase catalytic domain 0.0034
Further Details:      
 
Domain Number 2 Region: 36-138
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 3.4e-18
Family Glutamine synthetase, N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|8308|gm1.8308_g
Sequence length 415
Sequence
MVRRELAGEQAGSFKKPVKIRAESGPDSAYLSNTQTLKKYLSLEQSPKRIIAEYIWIDGS
NGMRSKCKTIDRTDEQVAKGRVTLEELPEWNFDGSSTGQAPGNNSDVYLRPVALYDDPFR
GKPNVLVMCETWMSDGKPNAFNFRHDAALLMEANAKEGFWFGLEQEYTLLDVDGWPFGWP
KNGFPAPQGPYYCGVGTGRVFCRDLVEAHYMACFYAGINISGTNAEVMPAQWEYQVGPCT
GINLGDELWMSRFILHRVAEDFGVKVTLASKPIPGDWNGAGLHTNVSTEAMRQDGGMKVI
EEAMEKLAKRHKEHMDVYGSDNALRMTGKHETASMDKFTWGVADRGSSVRVNRAVAEQGK
GYFEDRRPASNADPYQITGIIVETLCGKVDGANVHKTAVNAENVDLEMVVPISKP
Download sequence
Identical sequences A0A074YBZ4
XP_013340116.1.23603 jgi|Aurpu_var_sub1|8308|gm1.8308_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]