SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|84467|estExt_fgenesh1_pg.C_0_t10319 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|84467|estExt_fgenesh1_pg.C_0_t10319
Domain Number 1 Region: 35-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000211
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 2 Region: 94-132
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000017
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|84467|estExt_fgenesh1_pg.C_0_t10319
Sequence length 876
Sequence
MFENDNINKEELVEAHEALSSTGSRKKRRREDANFQCPQCHRVFGRIEHLRRHANSHGEV
RSFKCAACNKGFNRLDTLQRHELIHQKDPGVSKLKGARACKECASSKVRCNGTLPCERCT
SKSTDCVYPSASSPSQVQDSPSAHSDFGSTPGASDNASSSVLESAAFPRQLEQSLPHVVQ
GGHFTEQNVGTLADTWGFSTHSEMAPQATHHVEGSLPTYIHSISLQEARAQQPAMSPFEG
SYSGTEASFDIPYTSPFPRDRHASLDQLTRRPRLTPNLRSKTAIMGSNSPSSNLVLVSHQ
EEFIDRSELRGSFHRSFTPTTSYLSRRRRFNFPLSGDVLPAFQDDDYASFNMLSEQTYTA
IYKSFTTVCTGLTAYQPPYGSSCFPSRKTLNAFVKLYLERFHPVMPILHHPTLNLDTSHW
ILSLAIVTIGSHMSTFEQTEEYCLCFDELLRRSISALDPHETIDRITLCQAKLLACINQI
YSGEESWQESAYSEFLTDLVAFCQLEWKMSEAGFTTYAPEGQEAEFWKRWVQLESCRRTG
YAIWMLDTMWAYQFQVQPRLTLEDGRMPVPCQEVLWEAKTALNWHHIFQFSPSNITLLSS
LHSLQHEKSLQSTMGEFSRIVLLHGLYRQCWDMEKAEIHSRLRLHQISAYNLWRDSICES
LDILQWSANNVIHAASGIEHPTVLHLHLARIVLFAPIQTICDLAYGMTKEDTSVNVAQMA
SLRTAIRRWVVEDESKARLAVLHAGALLRHLHAFHTNGFYEPSAVLLATLTLWTYGAFTT
NVISTRSSTQRRFSDTQVHPISIALDQPLEADLARSFVKDGRDMMPTLRAVGSIRGAGGP
ERVLLEGSRLVSEIGRWGSGRKVMRILNNLSLCRSI
Download sequence
Identical sequences A0A074YRK0
jgi|Aurpu_var_sub1|84467|estExt_fgenesh1_pg.C_0_t10319 XP_013348878.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]