SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|985|gm1.985_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|985|gm1.985_g
Domain Number 1 Region: 9-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000027
Family HkH motif-containing C2H2 finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|985|gm1.985_g
Sequence length 270
Sequence
MSEYWKSTPKYWCKFCSTYVRDTNLEKKSHEATPKHQNNIQRSLRDIHKKTERDDREKQR
AKDEVARLNGLVAAKQGPSISVASGSQLPAPKLKSTAPSGPASVAERKRQMEQLAAMGVA
IPEEFRRDMSIRGEWSTVSETPIYSKSVKPDADDEDDTKAFGVRKRKLDEEEQDLNMAPK
AWGSRLKSYPPSKGNDEVDLDALLSSATTKKEVKSEDNHLLKKEGDADTTESIAAIPDIS
EGVAAESEVKPEPKADQDAPVVFKKRKSKR
Download sequence
Identical sequences A0A074ZM74
XP_013347842.1.23603 jgi|Aurpu_var_sub1|985|gm1.985_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]