SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|425402|CE311288_2601 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|425402|CE311288_2601
Domain Number 1 Region: 16-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000189
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 81-118
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000379
Family Zn2/Cys6 DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|425402|CE311288_2601
Sequence length 923
Sequence
MPENEPHISRDDAQRKCSTCNIVFQRTTHLRRHMLTHTQDKRFVCSICGKSFVRRDTLHR
HQITHRTNSIGGRIGSADALSSRACRGCATARVRCSRQNPCERCHSRQVQCVYEESDRTS
DSVPEQSASTTSVLPIEEVQMPPPNCATMIDQNTDNTIPQTRTPGTETGEPSFLLVPSSR
DAGEPARSLLGPTWTPQDPVVNPSYNYQDTSLVAPFVGRDTSSLPATNWLPYANGMDWDF
DFYMSQALNNFSPVMGLHSTSIWSPSTNPLDNNVLNIGTSPGGRSKGSIAEESPASMSVT
NSVSSSKRHGTFYADGEVSRLTRRRNAEVSNTQDHIGGMGSELEFTSTEMEPPTSDTALS
TPIPSHTYNRILQSFDNLCVTDNPLLHFERFRSNRFPSCQALETCLDSYFDNINSTFQVI
HRPTASLEGDGDWILCLAMAAMGAAISSSAPLVSNAEAFRTFLQRAITTQNVLARHNRRE
PELSFMQACIIYDVLELHLQVNINEDAMAGTRSFSDLCTNIKRSRWLGLKEPEWDITWRE
DDWKAWAHRESQRRVAYCAWLLDSWNLLTAGKTLSSNFSLGDVQTDLPVHEALWMAGTIE
AWLYLKTTHKQPVGLSRLLQSLYQQQPLVQELGDFAQTVAVHAVCRRTLEIGSHILDPLS
GLDAGQQQPGDSVRDIYWLPSDPEYQKWRNKALDCLDSLHWGTHAVIARLQGLEPPVVLH
LHMSRLILLVPYQDVYDLICEVHGDDTSLVQAGNSRSRREDLVAKIWLWISKDHYKSRLA
IVHAGAMFWYIRHHGTGNILEPTSLFMASIILWAYGSFVPLLQATSDDDHPAVPRADADE
EYDPTMIQIDRPCDDELIQIFIHRGNSMQPHMLAVGNICQPGGALGVLKVGAKLIKNRCA
AWPISKAYENLLLRCAQVSARPA
Download sequence
Identical sequences A0A074Y8G3
XP_013340882.1.23603 jgi|Aurpu_var_sub1|425402|CE311288_2601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]