SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|43915|fgenesh1_kg.28_#_12_#_Locus3949v1rpkm35.13 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|43915|fgenesh1_kg.28_#_12_#_Locus3949v1rpkm35.13
Domain Number 1 Region: 65-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000335
Family Phosphate binding protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|43915|fgenesh1_kg.28_#_12_#_Locus3949v1rpkm35.13
Sequence length 322
Sequence
MLSVGRPEYLHIADLSWSRYAHSAILTPDPDPAISNLVQTSATATYGDALAPLGFRLGNG
GAGHTGILKLLCEVFIASRGGGFKLEWVLNHSRHTQIALLGDVVQVALTYEPEYEELAVR
EGWAAKVSRVFNDHFILAGPREDPAALGPEPSITSAMAKIAFRGSSTQPELPAIFHTRAD
GSATYYKELELWQSAQVNLDTASSWRVRIPVTPYEALLEAESKGAYLITDRATYLTAKRD
GVLKSTTVFVEGGPQLLNPCSALINVKAPYNRLARDFASWLCSAEVQLLVRGFGRKWNVG
IPIFCVADQQDVAHEDRLLAKL
Download sequence
Identical sequences A0A074YBH9
XP_013340042.1.23603 jgi|Aurpu_var_sub1|43915|fgenesh1_kg.28_#_12_#_Locus3949v1rpkm35.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]