SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|532782|CE418668_1645 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|532782|CE418668_1645
Domain Number 1 Region: 10-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000107
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000397
Family Zn2/Cys6 DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|532782|CE418668_1645
Sequence length 949
Sequence
MPDVVTAGKSLSCQICNKSFGRSEHLKRHVLTHTRSREHQCRVCRKSFFRKDALSRHEYT
HRTSGPNLLRRGGRACIPCASSKTRCSGDVPCVRCQQRSLQCVHPVASLNQDDSAMDSED
TIQIDRGTPCSTFAPPISDDASQPFAGDHLNQAPQSLDQISDHQVSLLPTDQMLFPVPSL
SAMHITTMPYEQPTHIPLAATGHYHDSSRVDLHPFVPINYATVNWLGFEDANEVSGLPDG
QWPYPDCLFEFDITGNDSHNFSQISQVPTALRTAEYATNHPSAQLGQVPLTLCGVATGST
ISTDEASATPGEFYADGGTARLPRMRKRRAMSIYTTHEHTKESFSLALPSDFSFSAANQK
WIEAQAQADLENYFSMLCASSIIPFAPFESAVFPTKELLGHLCTLFVDHCGQILPFLHFP
TWRLRKQHPLLVLAMAAMGSHYLKDMNATRFVPSMYEFTRRVLFFAAESPGLFGIDSRTY
HQVILLYVVGAAYCGDDSLKEHAISLRSKLASLFFISHVDSKDTDQATIDPTNHDWCRWV
DRECSLRLRYCTWLVDYLLSCQFQVRPCLSLSDAKMPLPAEEDMWIAANTSEWSQLAIGK
ELLPELVVCVDELYMSKLLRAHVGEFARILLIYGLHRRLAEVELYYAQRLSHWTPGTFDR
PGGTTLPSLPIWPPALPIFKQWQNLTCDSLDVLHWAANATIGKASGFEHTTVLHLHLARV
LLLTPIREIVDLARYLAGERSLKSEAEIMTDRQVVHKWAVQHQYKARLAAIHAGVLFWHV
RRFSANAFYEPTAVAHATLVLWAFSAFSSKSARSLDNSRNELVQSTPVPNDMHASHDSSD
SESSSDTIILLDRPADDEIVQEFVMNGPRMRANMTGVGDLYGEKGPERVLREGSKILQTL
DNWRVRESWAKLLDKLIGVCKRERRKAREVSGRGRVARNVPSTRSEGEN
Download sequence
Identical sequences A0A074XYQ4
XP_013339171.1.23603 jgi|Aurpu_var_sub1|532782|CE418668_1645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]