SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|7022|gm1.7022_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|7022|gm1.7022_g
Domain Number 1 Region: 5-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.35e-28
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|7022|gm1.7022_g
Sequence length 352
Sequence
MATDKITFLSNWHATPYHAPVYLAQAKGFFKDEGLKVALLEPNDPSDVTEIIGSGKVDLG
FKAMIHTLAGKARGFPILSIGSLLDEPFTGVVYLKSSGITTDFRSLMGKRIGYVGEFGKI
QIDELTAHYGMKPSDYTAIRCGMNVTKAIIKGEIDAGIGLENVQMVELAEWLAENGKSRS
DVQMLRIDKLAELGCCCFCSILYIGNETFIRENPGKVRGFLRACKRATEYILASPAEAYE
EYVDFKPAMGTSLNRKIFERSFAYFSKDLKNVARDWNKVTAYGKRLGVLPEGYEPNYTNE
FLEWGLEKESEDPIGDQKKMVVLQEKVAEEGGFHRLGETVQGALVDAQACLM
Download sequence
Identical sequences A0A074YG69
XP_013341494.1.23603 jgi|Aurpu_var_sub1|7022|gm1.7022_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]