SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|71042|e_gw1.39.122.1 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|71042|e_gw1.39.122.1
Domain Number 1 Region: 18-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000352
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 85-123
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000114
Family Zn2/Cys6 DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|71042|e_gw1.39.122.1
Sequence length 904
Sequence
MVLPQTADAQMIPATTLLFQCTICQRAFSRVDHLSRHVRTHTLEKPYSCEFCDKKFSRVD
LLKRHACRQAPYGNSRTSKSHLGVTYRVGQACKACAASKIRCTDSKPCHRCVNKNITCEV
DCPEEPTHTPNLDTAGIAIQNVPPQTSDLSTPGELDLASVDIETQPALHSESLPSLVTSS
HTAADSVVLTPSLDSHSTMSCSFAVPATPNFDLNVAESSETYADFLKCLLDNGSYNNMYP
PLMSADDFSVGFWDDYLDANMSFQSNADVQGSVAPMIMNTSTTHTGSRNGSKDINTLEQK
AFHAAANAFEESGWNWSPSSQDHRSADHGGLSLPHDWARQESILQPDDDFLAKQMRPTDR
ERVMGLLLTYCSKQHLARMVSTFPSISALNGLVHRFLRCQISSHEPWIHIPSFDLTTIRP
ELLAAILAHGACSTPVEVITRLGYAMIDIVRTAVIDNWYSDNSLSRDLQLLQSLLLTLNL
AMWSGNRCMMEIAESTMGPSITIVRRAGWLREDLYPVIELQASEEGMQLHQKWTAWIQQE
SRKRLCYRTFLFDARVSLTRMTSPTMSFTEMTLPYPDKAELWSATNALEWKALYLEHCQH
KTPRSRVSLAEDMRALISESSIPVDCDTAWRNDVLLHGLWRLIWGHREVEDLLQISSPEH
DESSSSLPSRGEGLAKILNKLRLEVELASTMKPSDVTGDAIMIQEFLNMTLHASIQSLQA
FAGKDGVAAAQRVYPMLEEWTQSKSARRAVWHAGQLIRAAQATSTRPIREWRVVVVYHAS
LVFWAYGIISSIRQKRDAVSDTDSQTKAAVCLDGEQDTMVRRFINLGEGEPCLLNHSSSP
DASHDDSFISQKVPLRKASKIMQMTAQILTEQVAGDCRISPPLTERFARLMNELARSARA
IGLG
Download sequence
Identical sequences A0A074Y3Z3
XP_013339100.1.23603 jgi|Aurpu_var_sub1|71042|e_gw1.39.122.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]