SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM34.1180 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM34.1180
Domain Number 1 Region: 49-347
Classification Level Classification E-value
Superfamily ApbE-like 1.8e-57
Family ApbE-like 0.0012
Further Details:      
 
Domain Number 2 Region: 384-657,813-894
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-51
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 646-811
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 8.22e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00023
Further Details:      
 
Domain Number 4 Region: 997-1134
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.58e-28
Family Reductases 0.0024
Further Details:      
 
Domain Number 5 Region: 902-987
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000000000127
Family Ferredoxin reductase FAD-binding domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM34.1180
Sequence length 1147
Comment | organism=Leishmania_mexicana_mexicana | product=NADH-dependent fumarate reductase, putative | location=LmxMchr34:537654-541097(+) | length=1147
Sequence
MADGKTSASVVAVDAERAAKERDAAARAMLQGGGVSPAGKAQLLKKGLVHTVPYTLKVVV
ADPKEMEKATADAEEVLQAAFQVVDTLLNNFNENSEVSRVNRLAVGEEHQMSETLKHVMA
CCQKVYHSSRGVFDPAVGPLVRELREAAHKGKTVPAERVNDLLSKCTLNASFSIDMSRGM
IARKHPDAMLDLGGVNKGYGIDYIVEHLNSLGYDDVFFEWGGDVRASGKNQLSQPWAVGI
VRPPALADIRTVVPEDKRSFIRVVRLNNEAIATSGDYENLVEGPGSKVYSSTFNPTSKNL
LEPTEAGMAQVSVKCCSCIYADALATAALLKNDPAAVRRILDNWRYVRDTVTDYTTYTRE
GERVAKMLEIATEDAEMRAKRIKGSLPARVIIVGGGLAGCSAAIEAANCGAHVILLEKEP
KLGGNSAKATSGINAWGTRAQAKQGVMDGGKFFERDTHRSGKGGNCDPCLVKTLSVKSSD
AVKWLSELGVPLTVLSQLGGASRKRCHRAPDKSDGTPVPVGFTIMKTLENHIVNDLSRHV
TVMTGITVTALESTSRVRPDGVLVKHVTGVHLIQASGQSMVLNADAVILATGGFSNDHTP
NSLLQQYAPQLSSFPTTNGVWATGDGVKMASKLGVALVDMDKVQLHPTGLLDPKDPSNRT
KYLGPEALRGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNEYPGSGGSKFAYCVLNET
AAKLFGKNFLGFYWNRLGLFQKVDSVAGLAKLIGCPEANVVATLKQYEELSSKKLNPCPL
TGKSVFPCVLGTQGPYYVALVTPSIHYTMGGCLISPSAEMQTIDNSGVTPVRRPILGLFG
AGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKNTGLSMTEWSTVVLREVREG
GVYGAGSRVLRFNMPGALQRTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILA
RADKGRLAEWISALQPGDAVEMKACGGLIIDRRFAERHFFFRGHKIRKLALIGGGTGVAP
MLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEEEYGSEKFKCHFVLNNPP
AQWTDGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKGLGYNMNLVRTVDET
EPPSAKI
Download sequence
Identical sequences E9B5Z7
psu|LmxM34.1180 XP_003879114.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]