SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM04.0420 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM04.0420
Domain Number 1 Region: 187-221,255-356
Classification Level Classification E-value
Superfamily TPR-like 0.000000000293
Family Tetratricopeptide repeat (TPR) 0.066
Further Details:      
 
Weak hits

Sequence:  psu|LmxM04.0420
Domain Number - Region: 37-83,139-222
Classification Level Classification E-value
Superfamily HCP-like 0.00549
Family HCP-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM04.0420
Sequence length 361
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, conserved | location=LmxMchr4:145617-146702(-) | length=361
Sequence
MAEAQTRKRTESLSKMYSKKPISEGYALWDREYLLAAMRVFTFKAEGAPPFVLAPYLDSV
AEITLQMHDLEDAAEQFAIAAGKYQLIDQKVLADLMRFKVTEVSSSAEIALEQVQAYLAA
QDPQGNGGGDNSTTQTKSAFARVYAYLADLLLGSVDEEQPSEAVLAQALTAAELAVQLGW
DRDHCGWLIVGDVHAASGNYEKAKEAYGNALQRCPHYAKALERQIGVVQQLVRAAEECGD
DAGKATLHTELLTLLSRSIEVHPLANTFREKAFLLSEMHGDDAALVFVAETLEHPPQEEI
EVIGSSAREMTSTLLKAKAAILADGNQLDAALEAATKALAVDPNDEEAKSIIRDLHESMA
A
Download sequence
Identical sequences E9AK23
XP_003871808.1.65987 psu|LmxM04.0420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]