SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM09.0440 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM09.0440
Domain Number 1 Region: 301-539
Classification Level Classification E-value
Superfamily TPR-like 1.88e-22
Family Tetratricopeptide repeat (TPR) 0.0064
Further Details:      
 
Weak hits

Sequence:  psu|LmxM09.0440
Domain Number - Region: 153-175,227-258,291-331
Classification Level Classification E-value
Superfamily HCP-like 0.000366
Family HCP-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM09.0440
Sequence length 555
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical tetratricopeptide repeat protein | location=LmxMchr9:182058-183725(+) | length=555
Sequence
MDESMWFIQTKAMVLQSWYDDAEIEDDGVDDVLMEGEQAVVSTSHRPNTSLRAARQGTAG
GGTVAGRAGRLGTSAGGGRPVSSRYGYARPGTLQNRPGSVRGGPDGTAVRPVTGRFVRIG
TASLRSVPGGPHINLQALNLERYAQEKPMIAKLLCDYLLYVEHKPKMALELCTAALRPVK
SVTAPAIPLPSAPGVAAKLPMGGGGGGLPPAEKTAAASAAQEQVGIMNANDWWWKARLAK
ANYQLGLLREAEKYLRAALFDAPANTNVGPGMLKASPGGGGSRGGSQTARAFANYNTSVV
MQLGKVYLKMDQPLTALETYEAALEVNPVDHHIVLCCARLRDELHEPGTAYDLYNQVLHL
DSSNIEAIACIGAHLFYERNQPELALRYYRRLLQMGLHTSEVWTNMGLCAFYTFQMELSL
RCLSHALALCKEDSQRADVWYNIGHVGIGMGSMAFAERAFRLAVSADVTHAEALNNLAVL
AYEKRKEKTGRRLLDTAVLVAPRLTEALYNTAVIAFQAGELELSYQMVMRVLEAEPDHPE
AVVLQGKLRERFLAI
Download sequence
Identical sequences E9AMP5
XP_003872726.1.65987 psu|LmxM09.0440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]