SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM10.0820 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM10.0820
Domain Number 1 Region: 95-135,304-381
Classification Level Classification E-value
Superfamily TPR-like 0.00000000243
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM10.0820
Sequence length 400
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, conserved | location=LmxMchr10:397906-399108(-) | length=400
Sequence
MTTPGASPGGVEYSKKRQDDAEASELRRRMVQRATDAQRAGQEPLERQEGLSESDKWWPP
ENQNWSGRMFGSPFDKNKKKLDGMFVPELKEMFSPEKPLELSYEGDNFFINHDFHMADET
FEETRRFVPPPSFDPAIDEIDDDGFTDSKVMFDIQAALEEDKKRLEAFGNPMTVEDQVDH
LLAPQRDGQENVQQRQEFNGFVHWGLLHGAHMVLEENQDTKRAHEFVNRYMRDIDLFEKW
LEHPKVRAHIQKKFGIDMSAKFDKLMALTMAMYTRSKIQVYEDDPAGALKSLTASMSFIT
EGADLKKERHRKALGAVLVARGMIYCKLKSFHRADDDLTRALAFVKANRSATLYQLRAEA
REALGRIDEARADEERAAQIWEEAEVITPGMDGAPRKFVT
Download sequence
Identical sequences E9AN92
psu|LmxM10.0820 XP_003872920.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]