SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM13.0180 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM13.0180
Domain Number 1 Region: 30-66,249-289,369-403
Classification Level Classification E-value
Superfamily TPR-like 0.00000664
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Weak hits

Sequence:  psu|LmxM13.0180
Domain Number - Region: 295-413
Classification Level Classification E-value
Superfamily TPR-like 0.0266
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM13.0180
Sequence length 463
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, conserved | location=LmxMchr13:53084-54475(-) | length=463
Sequence
MCALPVMERTRGSTVQVCGERHTMSLSLATVLYADATRLYRLGDLHHARGAAEEALLSLS
LSPHRDISDHASHRHGGGDHEETADSVSVDCEVSQAQQRQRHRLFGNSLLLLSSIYMAVQ
DYAEAERLLVTCDGYWRERLTSTHTRLSSAGTSAEVECACCSELDEGLAGVAYNRAVLRL
EQLRRTPFSPASRGDGELWVASLVDVCGADARPTHSSIPLSSTAASSGTPETVLASVMAL
LLDAQDRLAHTLGPSRSLLADVLHTIGVCHYEAADYIAALQAWQRSMAIRVHLHALRQRS
DKDAAQRALRRGVGGDDGECGDGTEELKLALTMEHVAQVYRLLESRSVEALKLLDTVAAT
RRRYLGPTDPLFVRTLVLKGVLAAELGHTKLARALFDRCSAIYGEAGPETPPLSSSACAA
QEVEQWRLHPTPPCPSSLFSHHLSSTHRQGNAPGSRAGVDGQC
Download sequence
Identical sequences E9AP52
XP_003873229.1.65987 psu|LmxM13.0180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]