SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM16.1470 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM16.1470
Domain Number 1 Region: 11-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.22e-93
Family Motor proteins 0.00000342
Further Details:      
 
Domain Number 2 Region: 755-903
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000785
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 3 Region: 570-781
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000432
Family Tropomyosin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM16.1470
Sequence length 1052
Comment | organism=Leishmania_mexicana_mexicana | product= | location=LmxMchr16:624679-627837(-) | length=1052
Sequence
MRRAETIKHNNRVNVYVRVRAFREDETSGDMGQLAVNMDDSAVEVTVPKKGRFTFGFDGC
FWSNDRACPSGKPSASQEDVFEEVGRPLVENALAGYNAAVMAYGQTGSGKTYTSFGPPGS
IGTSQEGLIPRVCNMIFSRAANSAQKGVTYTVSASMLEVYLEDVFDLLNHRKQLSVRNDF
TSNMFSVVGQKTVPVKSYKDVLAVLNKAEPLRTFAATNIHDHSSRAHTLFMLEVQTHFDA
PDLAPRCAKIMLADLAGCERIRLAGTEEGLAFEQARNINLSLLALGSCIEAVATRGRGNS
RPIPEFRNSTLTKLLKDYIGGNSISTMMVTISPSERDANLSVQTLRFADRAKQITTHAHV
NTVDPQQAKQDGCDLSDRWRDEYLRKKEALYAEYQLKGTIEKLLARIAELEARLRECADD
ELALHLTTEVETLQKALTEADYQMGLQRQILYGEFLMLEDELRELNTKMQEMKEEHEEAM
EGLLGEEAGRFEEMKRGYETRLRALQSESDATLAASTDEIAALRRLVAELQERLAAKETE
CADLADRLSALQAKYDADTCASQRVRSELEAQLEELRNRSEERDEQLAMVEAQLEESERQ
VSELTKRQEQLMREEETLRATVERLTVAMESTEEMLQETSAKLADTEETLQETSAKLADT
EETLQQTSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQQTSAKLADTEETL
QETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQQTS
AKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQQTSAKLADTEETLQETSAKLA
DTEETLQETSAKLADTEETLQETSTKLADTEETLQETSAKLADTEETLQETSAKLADTEE
TLSAEIAFLAEQLGVAHTLGEQQGAYINQLMAYVSAAYGVTLDGMMEVQATALADMVRQC
DYVVRSVAQAASDEVEHIKEMYNMVDGNYKETAARLDILRRILGKIDQDVKEASVEIDVP
ERRLTGSLHPTPRRLGDVSNRENSMERKATMS
Download sequence
Identical sequences E9AQW0
XP_003873837.1.65987 psu|LmxM16.1470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]