SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM22.1470 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM22.1470
Domain Number 1 Region: 251-356
Classification Level Classification E-value
Superfamily TPR-like 0.00000251
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM22.1470
Sequence length 445
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, conserved | location=LmxMchr22:614536-615873(-) | length=445
Sequence
MLRRQCVARSYQRGSWAPGSKHQKHMSLNPTMYLYRFAGPHGPGPYVMKYWWTLGCFPTG
IERPFRLPEFLASYQQQHVPIEVEEWLQCFVKNPYEELKDATSSLLKCLEEVPTRENTRG
YRSIESGVSSFAAPLAQFERQLNVRVPFLAVRAALGSPALRERLKDDLFEYNESLSACGS
TPHRRLARSAFDEPLTLPGGISNSDDSENLRGQISVPMREGIGSYASPNPRTSDDEKKLI
RLLTTFSEGCALKEDYESAFSLLSSSLNFSHDDDIDAVVHSNASAAAILSGLYKEAEFHG
RQAALLEPQAMLSTKSGGRGYVLWAIATAYQEDFDRGSRIVEKGLEVFPDSADLKSIREK
LAGAVAAASSASPLRTRMIRSKGQQTRALLHGSGRSFDNEFDWVVFKNKLYPSKMNPSSN
EMGSVFRRVGDFGGHVSTSRSLEPL
Download sequence
Identical sequences E9AVX9
XP_003875601.1.65987 psu|LmxM22.1470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]