SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM25.1680 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM25.1680
Domain Number 1 Region: 1704-1738,1803-1891
Classification Level Classification E-value
Superfamily TPR-like 0.00000121
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Weak hits

Sequence:  psu|LmxM25.1680
Domain Number - Region: 1611-1648,1682-1734
Classification Level Classification E-value
Superfamily TPR-like 0.000114
Family BTAD-like 0.063
Further Details:      
 
Domain Number - Region: 1228-1261,1561-1649
Classification Level Classification E-value
Superfamily TPR-like 0.0163
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM25.1680
Sequence length 1936
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, unknown function | location=LmxMchr25:674083-679893(-) | length=1936
Sequence
MPKGDSVARGPAMTSQSKLASGAPPARSASSYRRSNARPRKQQQAAFPAIPSLGRMAPHS
PAVSRPAAAVPPWLSSASMRGTPAAQRMPSTHYAARNFFAAARVPRPPNAETWMARQTCA
GALPSSQVALAAAPTATDAPAYYVVGGAVVNPQLMVSPSVQEEIREVRSLSVVPDALLRP
GIGPQLNNTHGAAAAAASAGGETQRRSVSPDRARAFGGTLGAASGGASRRPRGRAASPTC
VASFSIDRSADDAVVTVEAIRTSRSRTESVPLLQQTLEITATASSLGLLRRLYGTTGEDV
IEVAHTNPRNGALEPPRLQYHLAQELLPELTGAEAQLKTLASARRRIDWDVNIPTADTLP
PPAIAFTAVSNGAPVTTLTSVRFRVDTSTLAMQRDYTADSATVIGGGTPAAGAAVASVGV
RPRTAKSALMHEEENVGLDITREDRIGSSGLYCIHHLVGLRPGLGEQVGLERVLEYKVIA
SVRDLFIAPPYINASTGDLFMELNTSLQGTAKLTITGVDCGSVDPVAGAVLKSSNTLTCY
LVLQHSTSAAATKVERDQAVASTLGGGGTHYARVPSAAARLARAITAGTAASAAAMAQRS
ARDSSGAEAQGADCFSLSLAHFNQETTGSMPAEASGASAGGLSRMPSPANDGVAAGAPNP
VAQQGRQAPFTQPRRNSLDVQSMAARNAAEAAAVAVGATAPYTGAENGAAVAISAAYAPA
AQNGAAAGGAAHDLRGGNGTVGTQTDSQNRAHHYLFPVTNPHELRYACYTEATRLRRLQQ
RKVQQAGDKAEQGAAAEKRCHQQPRHASANSSSGSPLQARTTLSNDEGDKDLSGTLAADS
DSRSQPATSSVGKERKRRKPKVEVLEPEQQLDTNSSVSALAMTSWEPQWSNSTTNSGGQV
SPAHRHSDASEATLGQSGSVCDADAAANHELRYPPLPTTFFFMDSLQSPLGYMRLTGWQD
RLITLFREEDKDLLRSEPRTRFKREALQELSDGALAGMIANLYLWNGGVGNSSASGSGRR
ASVHPRRGSSVAASRNLSSGIESIFYHSSTSINNPFAVLANRGCVTTNGCSAGGGVQLKA
SVEVTTEKTFAVLRRLILCLAVEEERASTQLYNDTVQLCSQFCHSALLKTTALTRGTREG
LQQAAAAILSAGSPASPRKMCTSGGGPDGNVGLSGKDIELLRSLEDALELSMTTMLIVGA
YGEAVEYALQRVHTLCLLEGDTDALVNAAQRDLAEAYFFYGDYVTAATIAEDVVMLTRQL
CDDAPDAYEVVEAELLCTVACVAAGKRDRLPHYIDNLELNMLPVNHGNDSVARAAQPLQQ
AQLRLVLVFAKTYLVRSGSVGATAGALAATRAATTASDDMQQNRSAAGSASPVSTGDMVT
LLREAVHLLRGKGDLQEMEQSFFTVFPGQVRPSITSNSGDTGISMMLPTGCREQGAFTTG
RASFKPVRVFGNPSTLSGGEGEDCGDVAAKMEAAQKRLRWNLLCLAGAQLLQNGHEQEGM
EVAESAVKELVLGKHRHVERNQRATLAAVLWVGLMLAKSRMQPGQVTDIMPILKEMADRV
VRTRGPLHPLAAKANLLYAYVAHYVTNNRHSASLATRSLAALERGVGPKSYDRLMAHYVV
GLMTEAQQRWRPAVEHLSAAYAIAQTNRLAEDDLILMDTQFLGAILLCPPTAVLDLDTAT
LCARFQERLQRLRERVGPHSERLVVPLWNMAELFYLLKDTDSAIECLQQTTRLLDHRGIL
LVSTDVLKPKDVLILEQQKTMSGSAGNEDCDGRTGRSCAAQAAEARERGERLVAQRNALV
QTSFDTVSQALHLATTLFMGAAMLESQGCTAEAREKYGQSLALYEASHLGDNTLAAVRIM
EALSKLLYTVGECSDALMWARKAVDLLHIHYPKEWSLEHAAARKLVDATEYRLLVMEGTY
VVQNGLPTHSEFVELL
Download sequence
Identical sequences E9AXP9
psu|LmxM25.1680 XP_003876225.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]