SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM27.0010 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM27.0010
Domain Number 1 Region: 138-253
Classification Level Classification E-value
Superfamily TPR-like 0.00000446
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Weak hits

Sequence:  psu|LmxM27.0010
Domain Number - Region: 44-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000136
Family Thioltransferase 0.032
Further Details:      
 
Domain Number - Region: 122-184,280-332
Classification Level Classification E-value
Superfamily TPR-like 0.0249
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM27.0010
Sequence length 374
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, conserved | location=LmxMchr27:3542-4666(-) | length=374
Sequence
MESRVPLLLYFMVTNHPDVKQYTELLCHQVDQANRRLKGEKFGDVYQEFGKDAGLAIKLG
TVDCLQEPGLMAKFQIDPHMFPLIYFVRNKVFCDKMIGVVSESHVKEAVEAFIDYAKLES
KNESEGLSLFQKIRRQDNDDENAMTLIAAAHGKMQAGDPAKGKQLFEKALRMSMEDIEVV
KKRYGVPNKKMTPELWAKLKREPCYNSAPEALCGLAMCAMASKQRDEAFRLAARVREEFP
FAPRDMRGVAEAVVRIELIQVVDYDPDTDNYMRLLKFDELVSEPAQFYKHHLKRAVAFYV
EGVAGQAIEECLRLIRAEPKLLSALKEGGIVPKDLRLGPTAVTPARQVIRGIFEALGPTN
EHVEKGRKLLQLYL
Download sequence
Identical sequences E9AYQ3
psu|LmxM27.0010 XP_003876575.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]