SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM27.1820 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM27.1820
Domain Number 1 Region: 774-1033
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000474
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number 2 Region: 1036-1289
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000741
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM27.1820
Sequence length 2269
Comment | organism=Leishmania_mexicana_mexicana | product=hypothetical protein, unknown function | location=LmxMchr27:783010-789819(-) | length=2269
Sequence
MSGSRTSLSSPSYAAQPARPPPAGVLSADLARPISVRELAQSRVPAVPPPPPATQTPRPS
ATTAGFAGFGVPTSSAVYAATSGVPTLQLLSTHTDAGDLTSLAHRDVDHLSGNELYNYAS
HLQESSKQYSGYLSEAYAKRDQYRGEVARLKEELHNRYMQIDVLRREQARATDALVKVRE
DNAQLRQKLAEAEGHTRNMQAKMSVLSGADPSIAVHFYQSQLALKDAQLRELQQECERAA
AASSQRRSSSTTAAEHGRRSANISGEGAAAPHTSPSCDLPSTEELQERAEAASAALPTAL
EELQRLNISLSHRLEEEHAAHKAALAAHAEASATARADRAELLDTIAQLRQQCADMQSAE
DELVAALTQRAPISKKDYAALQASYDDLTAALAKAEAQVAALQEKEQQHDHIARQAEEEL
RHLLTTGQEERQSMQARNEHMQSLVYHLERELELAERANQLRQEQLDAAISGNQQLAESL
HVAQEQLLSATAELQDLRDTCESLESQLRELQQRIEELEQADQHQRHQHGDAEAERTLIH
TSAASAESEALQQRQELEAELASLCSQRDALVGDRDDIIGEMRRLQDERLALLTSPPAQA
EEQLQRRSSAVKAPQDVRADDGEWQAQEDIAALEAAHQCIEQMKQTIAALQSESARVEAD
LKAEVNTLKAELASQSRALTGAQAAAAAQQAHLEEVMLALRDELVATQAQEKRLRASEEA
HRERCVEQQRVMEQLQQHVEELERAARDAASSLSTPPPDQPTTAAESELSAMNAALDSLA
NELEDAQLRAEQLAAEHARTVEELARGTRAVAELEARAADTEGKREAMHTAAEATEAELM
ARVAALAAENAQLKEKLSTSRAAVTTFASRQTDGESTAAPLEERCAAAARRSEAAEAEAS
ALREALSRSAAELVEVLQRSEDVQATLERTVARLAEQESLVGVLSAESVRVQDELASAQR
CVLMLTSERDALGEEAAGLHGKLSAAEDRASDAAAAQKRLQMRLEEAEAAVRSKDVELST
AFAALDRTASELCDAEQRLQAYSEAKEQLAAEHARTVEELARGTRAVAELEARAADTEGK
REAMHTAAEATEAELMARVAALAAENAQLKEKLSTSRAAVTTFASRQTDGESTAAPLEER
CAAAARRSEAAEAEASALREALSRSAAELVEVLQRSEDVQATLERTVARLAEQESLVGVL
SAESVRVQDELASAQRCVLMLTSERDALGEEAAGLHGKLSAAEDRASDAAAAQKRLQMRL
EEAEAAVRSKDVELSTAFAALDRTASELCDAEQRLQAYSEAKEQLAAEHARTVEELARGT
RAVAELEARAADTEGKREAMHTAAEATEAELMARVAALAAENAQLKEKLSTSRAAVTTFA
SRQTDGESTAAPLEERCAAAARRSEAAEAEASALREALSRSAAELVEVLQRSEDVQATLE
RTVARLAEEEALVEQLNYDASELNVARAALSDEVTRLQRALAVALTDKSDVVAQLLATQK
ELDRAAELQDAQYRDEERLQDALATTTSAFDVQTKQVRLGMAHVVDMSRAFCRVAEVAVQ
WSAAQTDGLASTGASVQEMLSPWSRALEWVAGMEQRLEALDIGAMLNSFSRTDGRRERRR
RRRRGRTTESEEDDAAEEEPSSGSNALSLSSLCRAVPANRAEVAFARLMDAQAAAMNTIA
DLRRTLADKEADLTNLRSAMDALASDLMGERDRADNLSAAIDDASEKIGSAQAEFEEQLR
QRTAATTAEVVEARRAEARATAAQLRAEKQLAAVENDRKEQEAVLRKLQDENHRLAREAD
RLLRTSRLEPSSRVRSNGSGSVTPKSLSLSATSAEDAVQRFTTAPSTVEAAEQAQILQVS
SLQADLMLSRRQARELEGREATLRQACAALEQQVNELRVEAAEAEHLREDLATLRADYAE
LEQRYSELERMATAAGGGTMQELKQLRQQLKVREAELEELKARMQDLVLSKAAPELEAAR
RQEALRESLSGITTQLAATQAQYGGGTGGSNKARSRRASLTDALSNSDLLSLSSSRPSPQ
DVLTSRIEHLQTLVHDREVALEKVQAAQLESRAAMDMLEDQLAAKTAALERSEGLVAEYA
DTINTFTMTAVVRRGNHGARPTTAPPLSSGMGSPDAEALSTSVPPLTPLTPRTRAAVNGQ
SHTAVAMASPAPRMPNLDEVADDSDGSVEGKHADSAGPSTDSAPPPVTHRRTGASGSWRS
AKSCPAHHPSSSTERSAPSSPSTVPGRKSSAGASMPAATRKRTRSSTNA
Download sequence
Identical sequences E9AZ84
psu|LmxM27.1820 XP_003876756.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]