SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmxM31.1730 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM31.1730
Domain Number 1 Region: 168-305
Classification Level Classification E-value
Superfamily TPR-like 0.000000000329
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Weak hits

Sequence:  psu|LmxM31.1730
Domain Number - Region: 14-35,104-201
Classification Level Classification E-value
Superfamily TPR-like 0.0526
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM31.1730
Sequence length 323
Comment | organism=Leishmania_mexicana_mexicana | product=coatomer epsilon subunit, putative | location=LmxMchr31:676022-676993(-) | length=323
Sequence
MTDVLFDVRNALVVGNYHQAIADGSTARALSSRPVDVAAFNAEKNAVIALGQIGLGQVDA
VISQLRSERNPLLVTIHTWAELICAMRDYGALSDPVTNVTQRLQSDAETVAADAVYKAVF
AATALFYQQDVIGALTLAKKWLGELPTPEGSLVRRYTVELHGVAIEALLRLNRPDEAAKE
VKRMEQVDSEAIVTILYSGIVSLHQAASDVHAANYDAAVSAFKEVQLRCGQSIMVSNLMA
LAHMGLKDYDAAERSLLDALAVRSNDEATLVNLAAVSAHKAKSLDDAERYIQQAVSMHGT
WGDAYHAKERNLDQDISAFMVEV
Download sequence
Identical sequences E9B2U9
psu|LmxM31.1730 XP_003878017.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]