SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805350|ref|YP_005841748.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805350|ref|YP_005841748.1|
Domain Number 1 Region: 44-211
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000319
Family ATP-dependent protease Lon (La), catalytic domain 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|385805350|ref|YP_005841748.1|
Domain Number - Region: 292-382
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0312
Family L-aspartase/fumarase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805350|ref|YP_005841748.1|
Sequence length 601
Comment serine protease-like protein [Fervidicoccus fontis Kam940]
Sequence
MRHYRNKSEKFFALFFTSLFILFLVVYPIITNASEIAGKSIEIFVPAVTEKGGVILKLKI
SLIPNGSGNIYIKGALFAGNDTLNSAAVAFYVGLLMANKNPMNYNGIIEFTSPLTQIEGP
SASLAIAEAFYMLAKDMNPTSLSSSVITGAINIDGLSVIIGGVEDKLNASINSGASYFYL
PYSNYNLLAETNSIQNIGNINIIGVGGIASLSNSLRGINALPSIYMNAVMPTDISNYMGE
VALYFMNKTKEISYNFSISNFTDITNLVSQGENYTASSLSFTLYIDSLYYYLQQSLNNKT
LVEEYIKKVNETINELKEKTLEDENKLTNNDKIPISLFEIFSTEEERIWEAQGYLNMASQ
SQQQNDTAYYLAYAIGRLETAKTWYDMSKLNISEGQLLNLEAFQNSMKQYIDFLSIILNY
INSIISQSSDASVQNYYKELLDIYNKICSNSTDIFLKYSLASVLTYDATSLLSSMNYIDE
YTMQEYYNEDLYNFEIFYSNLLSNGISLFIPLAYYQYSSSNLLTYDNRLYLLENSISCIL
PFLFYSFNANLLYSTSPSSQVKLVIPSQNIIFETLLFWGVGSAIAAFFSLLIYHTKKKIN
M
Download sequence
Identical sequences H9ZZY9
gi|385805350|ref|YP_005841748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]