SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805466|ref|YP_005841864.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805466|ref|YP_005841864.1|
Domain Number 1 Region: 8-220
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.07e-63
Family FAD-linked oxidases, N-terminal domain 0.036
Further Details:      
 
Domain Number 2 Region: 223-476
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 8.01e-48
Family Vanillyl-alcohol oxidase-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805466|ref|YP_005841864.1|
Sequence length 478
Comment D-lactate dehydrogenase [Fervidicoccus fontis Kam940]
Sequence
MLKSKKTIAKDLSSIVSDGNVITDESTIKVYAKNASHMEGNAIAVVFPNNTEEVSEIVKY
CYKNNIKIYPQASASELTGSSLPREDGVIVSFERMNKIKNINILDSYVVVEPGVRLYDLN
LELSIYGFMFPIDPASIKIATVGGAINTGAGGMRGVKYGTMKDWVNELEIVIPNEYGTIL
KIGCKTSKCRQGYDLVRLIVGSEGTLALVTEATLKITPLPENVITLAAFFDDIEGLVNAL
LEIKKNKLDILIMEFVDDKSVELTLKVLKINIAGNGHYFVTSIITSPESSERVLSLVENI
LKRNGAKNVYKAKTLDEAESEGIFDIRRNYDIGLRDLVVKMRKNPASKIIDYNEDISVPP
SKLPEAVRRIREIEKRYGLPLTLAGHVGDGNLHPVIKIEEKNIEQIETYEKMKSEILKAV
IELGGTVSSEHGIGLDKKKDLIMELKSKNSVKAIDIMKSIKQTFDPKNILNPGKIFEV
Download sequence
Identical sequences A0A2J6N8S3 I0A0A5
gi|385805466|ref|YP_005841864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]