SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805497|ref|YP_005841895.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385805497|ref|YP_005841895.1|
Domain Number - Region: 83-130
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0179
Family Biotinyl/lipoyl-carrier proteins and domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805497|ref|YP_005841895.1|
Sequence length 145
Comment hypothetical protein FFONT_0453 [Fervidicoccus fontis Kam940]
Sequence
MVNICYRLEDDKKIPSVKNYLKSNENIESKLDISLDRIACEEIIFNNISFGERNICVSKG
NFIIKTPKNSFLIERNEELKYFIIEASQINTRKKPGDSVKKWDEIAVSKSKKGILRRIKI
PFEGQIILVEQDPTYKPERIVFILK
Download sequence
Identical sequences A0A2J6N3Y9 I0A0D6
gi|385805497|ref|YP_005841895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]