SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805528|ref|YP_005841926.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805528|ref|YP_005841926.1|
Domain Number 1 Region: 4-200
Classification Level Classification E-value
Superfamily Flavoproteins 6.21e-41
Family Hypothetical protein YwqN 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805528|ref|YP_005841926.1|
Sequence length 242
Comment NADPH-dependent FMN reductase [Fervidicoccus fontis Kam940]
Sequence
MKNMSAKILFIDASARKGGNSTKLMYVAELGARKRGCETEIIYLKDHKIKPCAGCVSDDI
MACKFPCVIDDDDFNSLARKLIESDGVVIATPVYWYMVSGIMKNFIDRLTSLENMLFHTG
KSLVDGKVAAFIATGSDTGTSMTIAYLMDVFNSFGYHIPPWSLAYHHSIDDSLDNGFAVY
DAYNLGINVCRAAEIMKKEKEPWYSFEYDLNEIKNYAKRMAERDGKNDSLEKRIEKAKGD
EC
Download sequence
Identical sequences I0A0G7
gi|385805528|ref|YP_005841926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]