SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805588|ref|YP_005841986.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805588|ref|YP_005841986.1|
Domain Number 1 Region: 166-434
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.5e-68
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 3.96e-54
Family Malic enzyme N-domain 0.00000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805588|ref|YP_005841986.1|
Sequence length 441
Comment Malate dehydrogenase (oxaloacetate-decarboxylating) [Fervidicoccus fontis Kam940]
Sequence
MSRGEKKDWASISEKLHKSYRGKIEVLPKVPITSLDDFSIWYTPGVAEPCKRINKDEDLS
YEYTLRWNYAAVISDGTRVLGLGNIGPSAGLPVMEGKSLLFKYLGGVDAIPLVLGERDPE
KFIAVVKALEPTFGAINLEDIESPKCFYILERLQEILNIPVWHDDQQGTALVILSALINA
LKLTGRRIKDTKIVLVGIGAANMATYRYLKVAGANPKNIIAVDKNGIVHPERDDIKREKD
RNPWLFKVAEETSPEIRGGIPEAMNGADVVIAASAPGPGTIKKEWVSKMNKDAIVFAEAN
PIPEIWPWEAKETGAKIVATGRSDFPNQVNNSLGFPAVFRGVLSVGAKKMNDDMFLAAAY
AIADYTEKTGLSKDRIIASMDEMELYVQEALAVALKAIDLGLARRKISKNELEREIREMI
ERPKKYMNIAIKNGIIEDRRE
Download sequence
Identical sequences I0A0M7
gi|385805588|ref|YP_005841986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]