SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805669|ref|YP_005842067.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805669|ref|YP_005842067.1|
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-53
Family ABC transporter ATPase domain-like 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805669|ref|YP_005842067.1|
Sequence length 216
Comment ABC transporter [Fervidicoccus fontis Kam940]
Sequence
MLRLKEIEAWYGDRIVLNGVSLSADEGELMRIRGRSGSGKSTLLRIMSLLQKPNVGEVEV
LGKSAWSISEGEREELRGKISYIPQFLELIENLTVLENVQLALEVRGIENGEDRAREALE
VLGIRGFEERLPRELSGGQRQRVAIARALVSSPKILIADEPTSFLDDIASSSFYRLLEEL
SSSFKMGIIVSTTELNLPKRSGWREMILEKGSLREL
Download sequence
Identical sequences I0A0V8
gi|385805669|ref|YP_005842067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]