SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805769|ref|YP_005842167.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805769|ref|YP_005842167.1|
Domain Number 1 Region: 184-425
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.32e-66
Family Aminoacid dehydrogenase-like, C-terminal domain 0.000000492
Further Details:      
 
Domain Number 2 Region: 5-183
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.38e-61
Family Aminoacid dehydrogenases 0.000000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805769|ref|YP_005842167.1|
Sequence length 426
Comment glutamate dehydrogenase [Fervidicoccus fontis Kam940]
Sequence
MVMNLSKYFEWELGVLKEAVNLAGLPSEVFDYLSKPDRIIQVKIPLRLDNGKLVVFEGYR
VQHNNALGPYKGGIRYHPEVTLETDMALALGMTLKNSLAGIPYGGGKGAVKVDPSKLSMR
ELEALSRTYVRGIYKLIGPEEDIPAPDVNTNPQIMAWMVDEYSKLTGKNVPAVFTAKPPE
LWGNPVRIYSTGYGVAVMAKEAADLWMGGLKDKKVAVHGFGNVGSYAAYWISKFGAKVIA
ISNAYGSVYDPEGIDVELALKSPEILKDVRNYPRGQKSNDPDTILYTDVDILLPCSLENV
ITAEKAKNIKAKLIVEGANGPTTPDAEKILYSRKDFVAVIPDILANAGGVIMSYLEWVEN
LQWYFWDEEETRQKLSSIMSNNFNRTNIYWNKLRERHPERLVTMRDAAFALAVERVYTAM
KLRGWI
Download sequence
Identical sequences I0A158
gi|385805769|ref|YP_005842167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]