SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805800|ref|YP_005842198.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805800|ref|YP_005842198.1|
Domain Number 1 Region: 190-275
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000641
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 
Weak hits

Sequence:  gi|385805800|ref|YP_005842198.1|
Domain Number - Region: 54-126
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0017
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805800|ref|YP_005842198.1|
Sequence length 291
Comment putative permease (drug/metabolite transporter superfamily) [Fervidicoccus fontis Kam940]
Sequence
MKEEGKALVFFLIYVIGSVPLNFFVKDLLEYFSIGFSLFIRFIIMLLFTILFSKKIILNK
NIAVLSFFVFLSTTLWLYSLIYLSPADSLVLSYSMPLIASLIGRRILNEKSGEIYGVLVA
FLGYIAYSYNLMKGFTLYGTVLSFINAFAWAYYSVLYRKLRTFDVFVLNSSVFLICSLFS
LAVLPLYQPIIKAGADDNVFADVIWFATIGGAIQFLSWNRVLSIWSASKATVLSYIVPIL
TFIIQCFSNKESPSLLQVIGIALITIGVILTFRNELKNHSNSSLSDESISL
Download sequence
Identical sequences I0A189
gi|385805800|ref|YP_005842198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]