SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805916|ref|YP_005842314.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805916|ref|YP_005842314.1|
Domain Number 1 Region: 136-362
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.49e-59
Family Creatinase/aminopeptidase 0.00000831
Further Details:      
 
Domain Number 2 Region: 14-135
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.00000000000000192
Family Creatinase/prolidase N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805916|ref|YP_005842314.1|
Sequence length 362
Comment exopeptidase, family M24B [Fervidicoccus fontis Kam940]
Sequence
MKEVKRGRVKKILSYGLDSIVVTSGSNFFYLTGLKIETFERPLLLFMSEDYSFLLAPKLE
MERLGDLNVTESLFYDDATDPFKIIESTPTLKNILRKGVKIGVDPNLRFSFFYKLNNIFK
DVNFVDASEEIQLARMIKEEEEIKNIEKASNILSKIFETAQESISPGISEAEVRFNLMKK
ASELGASSYDFIAIQSGENTAIPHHEFSSRKIRRGDLIVIDAVVSYNWYNADLTRVFSLG
KPNEEVLSIYSFVRQAQKIGIESSISNVTAKSIDEKVRNYFKEREIDQFFIHRTGHGLGI
DAHEKPFISSTSNDVIENGQVFTIEPGLYFPGKFGIRLEVDVVIKEGKPHIIGDFPLDIV
II
Download sequence
Identical sequences I0A1K5
gi|385805916|ref|YP_005842314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]