SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805995|ref|YP_005842393.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805995|ref|YP_005842393.1|
Domain Number 1 Region: 83-201
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.00000000000116
Family V-type ATPase subunit E 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|385805995|ref|YP_005842393.1|
Domain Number - Region: 13-72
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.0604
Family Ribosome recycling factor, RRF 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805995|ref|YP_005842393.1|
Sequence length 205
Comment V-type ATP synthase subunit E [Fervidicoccus fontis Kam940]
Sequence
MEEGNIESLLEYVINKVINEFKDTVEELRKDAHELLDDAYKNTKNSLVKELSDLYENYVE
SVNNLRSLRQYEIKIKTQEKKAEIVDLALKEVEKKIFYELDKEEKKIIYEAILSKLKESI
KLTNGEIHIEKEDKDLVSKIIKKKLEDSKEKIKIIDDLPSGTGGIKFVSQDGSTVYDFTL
KKIFELSKFELASIVYNVLFGGEEK
Download sequence
Identical sequences I0A1T4
gi|385805995|ref|YP_005842393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]