SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385806190|ref|YP_005842588.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806190|ref|YP_005842588.1|
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily LigT-like 1.74e-35
Family 2'-5' RNA ligase LigT 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385806190|ref|YP_005842588.1|
Sequence length 184
Comment 2'-5' RNA ligase [Fervidicoccus fontis Kam940]
Sequence
MAIEVNDPNVVSKIINIEEQMLSLKVPMKVVEKENLHITLAFIGEISEDTLQDAIEAIKE
IEHTKIKAKLKGIGAFPNSNSPRVVWIGVDDKASISIMELYKKVSSSLVAHKVPFEREKD
FTPHLTIARIKGRENIKRLASFINEFSSIEIGEVVFDKLKLKKSTLTPKGPIYDDILSKD
LREG
Download sequence
Identical sequences I0A2C9
gi|385806190|ref|YP_005842588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]