SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385806226|ref|YP_005842624.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806226|ref|YP_005842624.1|
Domain Number 1 Region: 158-293
Classification Level Classification E-value
Superfamily DNA primase core 0.000000000000471
Family DNA primase DnaG catalytic core 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385806226|ref|YP_005842624.1|
Sequence length 410
Comment DNA primase [Fervidicoccus fontis Kam940]
Sequence
MKYLIKAKIEIDGVVDKNDVIGALFGQTEGLLSPDLDLRELQDKGRIGRIAVDLKPQNGK
IKGEIKIPSNLDKAETALIAALIETVDKVGPYNAKVQVTRIVDLRIEKLKKAVERAKELL
KTWQSAEAPDVKDLLKEIQSSLKPAEIIEYGPEKLPAGSEIEKSDTLIIVEGRADVLNLL
RYGYNNAIALEGAKGTIPESVKQLASKKQKVIAFTDGDHAGELILRTLLNNVKIDLVAKT
PQGKEVEDLTGKEIEMALQNAVPPQQFLSELEKREEKEEVTQKELEKKEEKLAPQITVTE
EQQKPSMPLSIEIPENVMKDMNELKGTLEAILYDDNWNVVARVPVRDLYDTLSKLEANKV
KTVVFDGIITQRLIDIASQKNVSYLIGARIGNVLKRDEKVVLLSMYDLLS
Download sequence
Identical sequences A0A2J6N6T7 I0A2G5
gi|385806226|ref|YP_005842624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]