SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385806328|ref|YP_005842726.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806328|ref|YP_005842726.1|
Domain Number 1 Region: 192-536
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 3.66e-112
Family Nqo4-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 15-193
Classification Level Classification E-value
Superfamily Nqo5-like 1.83e-35
Family Nqo5-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385806328|ref|YP_005842726.1|
Sequence length 563
Comment Component HyfG of membrane-bound [Ni,Fe]-hydrogenase [Fervidicoccus fontis Kam940]
Sequence
MTEERISYYIKQLDSNFKSDIISIERTYPDKVFVGIRKDALLKICSYIFWELGGFLSTMS
VSDMRKINGSFRLDYVFSIEEKEESSSPKPWIIVYTMIPGNNPRFQSVTPELPAANWYER
EAKDLFGVIPEGHPDPRKLILPDDWPDGIYPLRKDMDYTIRPGEVKPAEYKWPKEEGITT
YIAGPIHIMADEPGQFRIYLDGEIVVDLDYRFSYAHRGVEKLGEARLTYNQVPFLAERIC
GICGFVHSTSYVQAIEEAMKIDVPERAKYIRTIMLEIERATSHLLWLGLASHLAAFDWGF
MQLWKVRERLMNLAEVLTGARKTYGINVVGGVRRDIIEERRKKSLEILKKTEVELKDIGE
TVLKTSTLLKRMEGIGVLPKDVARTLNVVGPVARGSGLYRDVRKDHPYAAYRELSFKIPL
YTEGDILARFLVRYEETFESLSIIEQALDRLPNGPIFEEVKEVEAYRPAIGAVEAPRGEV
VHFAIIGEDSKIYRWRVRAPTYSNWPSVPYMSRGYTLADVPLIVASIDPCYSCTERVEVV
DVRTKRVEVVEYEEIIKRSKKGV
Download sequence
Identical sequences I0A2R7
gi|385806328|ref|YP_005842726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]