SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385806402|ref|YP_005842800.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806402|ref|YP_005842800.1|
Domain Number 1 Region: 9-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.81e-51
Family Extended AAA-ATPase domain 0.000000455
Further Details:      
 
Domain Number 2 Region: 231-323
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 3.95e-20
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385806402|ref|YP_005842800.1|
Sequence length 326
Comment replication factor C small subunit [Fervidicoccus fontis Kam940]
Sequence
MSDENSENYLLWAEKYRPRSLDEIVDQEETIIRLKKFVKEKNAPHMLFAGPPGTGKTTAA
LAFAHDLYGKNYQQFVLELNASDERGIDVIRGKIKEFARTSVVGGVPFKLIILDESDNLT
SDAQQALRRMMENFTLTSRFILIANYPSKIIEPIQSRTALFRFSPLKKEDVIKRLKWILE
NESVSYEESALEAVFEISEGDMRKAINVLQSASAIGKVTVDTVYKVVGLAHPKEIREMLN
LALSGDFNGARERLRKLMMDYGLSGVDVIKQIHKEIFSNEIDLSEEMKLMIADYTGEILF
RITEGSDDEIQLNSFLAWLVLLRKRI
Download sequence
Identical sequences I0A2Z1
gi|385806402|ref|YP_005842800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]