SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385806246|ref|YP_005842644.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385806246|ref|YP_005842644.1|
Domain Number 1 Region: 17-308
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.15e-74
Family PFOR PP module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385806246|ref|YP_005842644.1|
Sequence length 318
Comment 2-oxoacid:ferredoxin oxidoreductase subunit beta [Fervidicoccus fontis Kam940]
Sequence
MSSESKQLKNIFDIPREELFVGGHSMCAGCTAPIIIRHLLKVAGKNTIIVNATGCLEVST
TSFPYTAWKVPWIHVAFENTGAVASGVESAIKAMKMKGILDPNEEINIIAVAGDGGTFDI
GFQALSGMLERGHKVMYVLYDNEAYMNTGVQRSGGTPFGAWTTTTPVTKRIRGEWRNKKD
IFDIVIAHGVKYAAVANPAYTVDMMNKFKKGLEQEGPSFMHVLMPCTTGWRFDPKYGITI
ARLATETAIWINYEYDNGKLDVTIPVKKRKPVKEYLKMQGRYAHLNDVEISYIQEQVNKK
VEEVNKKVGREVIGPLEA
Download sequence
Identical sequences I0A2I5
gi|385806246|ref|YP_005842644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]