SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00010986m|PACid:23793726 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00010986m|PACid:23793726
Domain Number 1 Region: 29-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-20
Family Ubiquitin-related 0.0035
Further Details:      
 
Domain Number 2 Region: 210-289
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000274
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00010986m|PACid:23793726
Sequence length 290
Sequence
TPARLLSPATPHFSPSVSPSASSIPNGGGEMKVTVMTADEQILSLDVDPDESVENLKALL
EVETRVPLRQQQLHFNGKEMQNSDKLSSIGVHDGDLVMMLPSNERASQDVLKLNPDGTAA
NPQAFQQHVRGDSQLMAQLLQSDPQLAQAILGDNINELQNILRSRHLQKMELKRKQEEEL
ALLYADPFDVEAQKKIEAAIRQKGIDENWEAALEHNPEAFGRVVMLYVDMEVNGVPLKAF
VDSGAQSTIISKSCAERCGLLRLLDQRFRGVAVGVGQSEILGRIHVAPIK
Download sequence
Identical sequences Pavirv00010986m|PACid:23793726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]