SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00030574m|PACid:23821214 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00030574m|PACid:23821214
Domain Number 1 Region: 143-220
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.32e-23
Family Skp1 dimerisation domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 46-100
Classification Level Classification E-value
Superfamily POZ domain 0.00000294
Family BTB/POZ domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00030574m|PACid:23821214
Sequence length 223
Sequence
MAPPATAAGKRTMPPQGDPADAAAVGATTEQEPQAAGGAEAGDLVLVADCGAEVRLSRPA
ARMSSTTVHMLDDCAEGRVPVAGVHAGVLRLVAAYCERHAPHYDPAASAARLRDPFPPFP
IDFPPTAHAIRPVTDPGPDPHGLEAWDDNFISDLPDNAALFAVILAANYLGIEDLLDLGC
TAVADKMRGKTPEQIRVALDIENDYTPEQEAEVRRENAWAFED
Download sequence
Identical sequences Pavirv00030574m|PACid:23821214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]